NCBI Conserved Domain Search (2024)

NCBI Conserved Domain Search (2)
NCBI Conserved Domain Search (3)

NCBI Conserved Domain Search (7)
NewSearchNCBI Conserved Domain Search (8)Structure HomeNCBI Conserved Domain Search (9)3D Macromolecular StructuresNCBI Conserved Domain Search (10)Conserved DomainsNCBI Conserved Domain Search (11)PubchemNCBI Conserved Domain Search (12)BioSystems
NCBI Conserved Domain Search (13)

Conserved domains on[gi|1859876929|ref|NP_001371459|]

ViewNCBI Conserved Domain Search (14)

transcriptional repressor p66-alpha isoform 2 [hom*o sapiens]

Protein Classification

P66_CC and GATA domain-containing protein( domain architecture ID 10964881)

protein containing domains Med21, P66_CC, and GATA

Graphical summary

Zoom to residue level

show extra options»

ShowsitefeaturesHorizontal zoom:×

NCBI Conserved Domain Search (16)

List of domain hits

NCBI Conserved Domain Search (19)

NameAccessionDescriptionIntervalE-value
P66_CCpfam16563

Coiled-coil and interaction region of P66A and P66B with MBD2; This family is a short ...

137-1762.82e-16

Coiled-coil and interaction region of P66A and P66B with MBD2; This family is a short coiled-coil interaction region on the transcriptional repressors P66A and P66B. The P66A and B, or alpha and beta, complex with MBDs or methyl-binding domain-containing proteins via a coiled-coil region on each. This P66-MBD2 complex forms part of an assembly with NuRD, nucleosome remodelling and deacetylation protein. MBD2-NuRD binds methylated DNA and regulates transcription of eg, the foetal beta-globin gene during development.


:

Pssm-ID: 465178Cd Length:40Bit Score: 72.84E-value: 2.82e-16

 10 20 30 40 ....*....|....*....|....*....|....*....|gi 1859876929 137 SPEERERMIKQLKEELRLEEAKLVLLKKLRQSQIQKEATA 176Cdd:pfam16563  1 EIEERERMIKKLREELRLEEAKLVLLKKLRQSQQQKENIV 40
GATApfam00320

GATA zinc finger; This domain uses four cysteine residues to coordinate a zinc ion. This ...

417-4514.94e-08

GATA zinc finger; This domain uses four cysteine residues to coordinate a zinc ion. This domain binds to DNA. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contain a single copy of the domain.


:

Pssm-ID: 425605[Multi-domain]Cd Length:36Bit Score: 49.24E-value: 4.94e-08

 10 20 30 ....*....|....*....|....*....|....*.gi 1859876929 417 CAQCKTDFTCRWREEKSGAI-MCENCMTTNQKKALK 451Cdd:pfam00320  1 CSNCGTTKTPLWRRGPNGNRtLCNACGLYYKKKGLK 36
Med21 super familycl12769

Subunit 21 of Mediator complex; Med21 has been known as Srb7 in yeasts, hSrb7 in humans and ...

98-1672.95e-03

Subunit 21 of Mediator complex; Med21 has been known as Srb7 in yeasts, hSrb7 in humans and Trap 19 in Drosophila. The heterodimer of the two subunits Med7 and Med21 appears to act as a hinge between the middle and the tail regions of Mediator.


The actual alignment was detected with superfamily member pfam11221:

Pssm-ID: 463241Cd Length:134Bit Score: 38.34E-value: 2.95e-03

 10 20 30 40 50 60 70 80 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|gi 1859876929  98 PPSPDVIVLSDNEQPSSPRV--------NGL----TTVALKETSTEAL------MKSSPEERERMIKQLKEELRLEEAKL 159Cdd:pfam11221  32 PLPPNDPISPDKAPPQPEPEpdppeefeATQrelaRDLILKAQQIEYLidslpgIGVSEEEQLQRIKELEEELREAEEER 111
 90 ....*....|....*.gi 1859876929 160 V--------LLKKLRQ 167Cdd:pfam11221 112 QeavkekeeLLKKLDE 127
ser_rich_anae_1 super familycl41472

serine-rich protein; This serine-rich protein belongs to a family with large size (over 1000 ...

513-6204.16e-03

serine-rich protein; This serine-rich protein belongs to a family with large size (over 1000 amino acids), which a highly serine-rich central region that averages over 300 aa in length. Species encoding members of this family of proteins tend to be anaerobic bacteria, including Gram-positive bacteria of the human gut microbiome and Chloroflexi from marine sediments.


The actual alignment was detected with superfamily member NF033849:

Pssm-ID: 468206[Multi-domain]Cd Length:1122Bit Score: 40.37E-value: 4.16e-03

 10 20 30 40 50 60 70 80 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|gi 1859876929  513 GEARDWSNGAVLQASSQLSRGSA-TTPRGVLHTFSpspklqNSASATALVSR-TGRHSERTVSAGKGSATSNwkKTPLST 590Cdd:NF033849  459 SQGTSWSEGTGTSQGQSVGTSESwSTSQSETDSVG------DSTGTSESVSQgDGRSTGRSESQGTSLGTSG--GRTSGA 530
 90 100 110 ....*....|....*....|....*....|gi 1859876929  591 GGTLAFVsPSLAVHKSSSAVDRQREYLLDM 620Cdd:NF033849  531 GGSMGLG-PSISLGKSYQWEDDPAILLTEI 559
NameAccessionDescriptionIntervalE-value
P66_CCpfam16563

Coiled-coil and interaction region of P66A and P66B with MBD2; This family is a short ...

137-1762.82e-16

Coiled-coil and interaction region of P66A and P66B with MBD2; This family is a short coiled-coil interaction region on the transcriptional repressors P66A and P66B. The P66A and B, or alpha and beta, complex with MBDs or methyl-binding domain-containing proteins via a coiled-coil region on each. This P66-MBD2 complex forms part of an assembly with NuRD, nucleosome remodelling and deacetylation protein. MBD2-NuRD binds methylated DNA and regulates transcription of eg, the foetal beta-globin gene during development.


Pssm-ID: 465178Cd Length:40Bit Score: 72.84E-value: 2.82e-16

 10 20 30 40 ....*....|....*....|....*....|....*....|gi 1859876929 137 SPEERERMIKQLKEELRLEEAKLVLLKKLRQSQIQKEATA 176Cdd:pfam16563  1 EIEERERMIKKLREELRLEEAKLVLLKKLRQSQQQKENIV 40
GATApfam00320

GATA zinc finger; This domain uses four cysteine residues to coordinate a zinc ion. This ...

417-4514.94e-08

GATA zinc finger; This domain uses four cysteine residues to coordinate a zinc ion. This domain binds to DNA. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contain a single copy of the domain.


Pssm-ID: 425605[Multi-domain]Cd Length:36Bit Score: 49.24E-value: 4.94e-08

 10 20 30 ....*....|....*....|....*....|....*.gi 1859876929 417 CAQCKTDFTCRWREEKSGAI-MCENCMTTNQKKALK 451Cdd:pfam00320  1 CSNCGTTKTPLWRRGPNGNRtLCNACGLYYKKKGLK 36
Med21pfam11221

Subunit 21 of Mediator complex; Med21 has been known as Srb7 in yeasts, hSrb7 in humans and ...

98-1672.95e-03

Subunit 21 of Mediator complex; Med21 has been known as Srb7 in yeasts, hSrb7 in humans and Trap 19 in Drosophila. The heterodimer of the two subunits Med7 and Med21 appears to act as a hinge between the middle and the tail regions of Mediator.


Pssm-ID: 463241Cd Length:134Bit Score: 38.34E-value: 2.95e-03

 10 20 30 40 50 60 70 80 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|gi 1859876929  98 PPSPDVIVLSDNEQPSSPRV--------NGL----TTVALKETSTEAL------MKSSPEERERMIKQLKEELRLEEAKL 159Cdd:pfam11221  32 PLPPNDPISPDKAPPQPEPEpdppeefeATQrelaRDLILKAQQIEYLidslpgIGVSEEEQLQRIKELEEELREAEEER 111
 90 ....*....|....*.gi 1859876929 160 V--------LLKKLRQ 167Cdd:pfam11221 112 QeavkekeeLLKKLDE 127
ser_rich_anae_1NF033849

serine-rich protein; This serine-rich protein belongs to a family with large size (over 1000 ...

513-6204.16e-03

serine-rich protein; This serine-rich protein belongs to a family with large size (over 1000 amino acids), which a highly serine-rich central region that averages over 300 aa in length. Species encoding members of this family of proteins tend to be anaerobic bacteria, including Gram-positive bacteria of the human gut microbiome and Chloroflexi from marine sediments.


Pssm-ID: 468206[Multi-domain]Cd Length:1122Bit Score: 40.37E-value: 4.16e-03

 10 20 30 40 50 60 70 80 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|gi 1859876929  513 GEARDWSNGAVLQASSQLSRGSA-TTPRGVLHTFSpspklqNSASATALVSR-TGRHSERTVSAGKGSATSNwkKTPLST 590Cdd:NF033849  459 SQGTSWSEGTGTSQGQSVGTSESwSTSQSETDSVG------DSTGTSESVSQgDGRSTGRSESQGTSLGTSG--GRTSGA 530
 90 100 110 ....*....|....*....|....*....|gi 1859876929  591 GGTLAFVsPSLAVHKSSSAVDRQREYLLDM 620Cdd:NF033849  531 GGSMGLG-PSISLGKSYQWEDDPAILLTEI 559
NameAccessionDescriptionIntervalE-value
P66_CCpfam16563

Coiled-coil and interaction region of P66A and P66B with MBD2; This family is a short ...

137-1762.82e-16

Coiled-coil and interaction region of P66A and P66B with MBD2; This family is a short coiled-coil interaction region on the transcriptional repressors P66A and P66B. The P66A and B, or alpha and beta, complex with MBDs or methyl-binding domain-containing proteins via a coiled-coil region on each. This P66-MBD2 complex forms part of an assembly with NuRD, nucleosome remodelling and deacetylation protein. MBD2-NuRD binds methylated DNA and regulates transcription of eg, the foetal beta-globin gene during development.


Pssm-ID: 465178Cd Length:40Bit Score: 72.84E-value: 2.82e-16

 10 20 30 40 ....*....|....*....|....*....|....*....|gi 1859876929 137 SPEERERMIKQLKEELRLEEAKLVLLKKLRQSQIQKEATA 176Cdd:pfam16563  1 EIEERERMIKKLREELRLEEAKLVLLKKLRQSQQQKENIV 40
GATApfam00320

GATA zinc finger; This domain uses four cysteine residues to coordinate a zinc ion. This ...

417-4514.94e-08

GATA zinc finger; This domain uses four cysteine residues to coordinate a zinc ion. This domain binds to DNA. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contain a single copy of the domain.


Pssm-ID: 425605[Multi-domain]Cd Length:36Bit Score: 49.24E-value: 4.94e-08

 10 20 30 ....*....|....*....|....*....|....*.gi 1859876929 417 CAQCKTDFTCRWREEKSGAI-MCENCMTTNQKKALK 451Cdd:pfam00320  1 CSNCGTTKTPLWRRGPNGNRtLCNACGLYYKKKGLK 36
Med21pfam11221

Subunit 21 of Mediator complex; Med21 has been known as Srb7 in yeasts, hSrb7 in humans and ...

98-1672.95e-03

Subunit 21 of Mediator complex; Med21 has been known as Srb7 in yeasts, hSrb7 in humans and Trap 19 in Drosophila. The heterodimer of the two subunits Med7 and Med21 appears to act as a hinge between the middle and the tail regions of Mediator.


Pssm-ID: 463241Cd Length:134Bit Score: 38.34E-value: 2.95e-03

 10 20 30 40 50 60 70 80 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|gi 1859876929  98 PPSPDVIVLSDNEQPSSPRV--------NGL----TTVALKETSTEAL------MKSSPEERERMIKQLKEELRLEEAKL 159Cdd:pfam11221  32 PLPPNDPISPDKAPPQPEPEpdppeefeATQrelaRDLILKAQQIEYLidslpgIGVSEEEQLQRIKELEEELREAEEER 111
 90 ....*....|....*.gi 1859876929 160 V--------LLKKLRQ 167Cdd:pfam11221 112 QeavkekeeLLKKLDE 127
ser_rich_anae_1NF033849

serine-rich protein; This serine-rich protein belongs to a family with large size (over 1000 ...

513-6204.16e-03

serine-rich protein; This serine-rich protein belongs to a family with large size (over 1000 amino acids), which a highly serine-rich central region that averages over 300 aa in length. Species encoding members of this family of proteins tend to be anaerobic bacteria, including Gram-positive bacteria of the human gut microbiome and Chloroflexi from marine sediments.


Pssm-ID: 468206[Multi-domain]Cd Length:1122Bit Score: 40.37E-value: 4.16e-03

 10 20 30 40 50 60 70 80 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|gi 1859876929  513 GEARDWSNGAVLQASSQLSRGSA-TTPRGVLHTFSpspklqNSASATALVSR-TGRHSERTVSAGKGSATSNwkKTPLST 590Cdd:NF033849  459 SQGTSWSEGTGTSQGQSVGTSESwSTSQSETDSVG------DSTGTSESVSQgDGRSTGRSESQGTSLGTSG--GRTSGA 530
 90 100 110 ....*....|....*....|....*....|gi 1859876929  591 GGTLAFVsPSLAVHKSSSAVDRQREYLLDM 620Cdd:NF033849  531 GGSMGLG-PSISLGKSYQWEDDPAILLTEI 559
Blast search parameters
Data Source:Precalculated data, version = cdd.v.3.21
Preset Options:Database:CDSEARCH/cddLow complexity filter:noComposition Based Adjustment:yesE-value threshold:0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.

Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH

NCBI Conserved Domain Search (2024)

References

Top Articles
Design data models - Splunk Documentation
eventstats - Splunk Documentation
Greensboro NC Real Estate - Greensboro NC Homes For Sale | Zillow
Bible Gateway passage: 2 Peter 3 - New King James Version
Simone Biles in position to make 2024 Olympics after breathtaking floor routine as US injuries mount
Simone Biles qualifies for her third Olympics as Hezly Rivera snags fifth spot on the team
Emuaid Lawsuit
4 Movierulz
App Discovery is Coming to Discord
Grow Community | Discord
Molotov co*cktail · RUSSIA OBJECTIFIED · Russia in Global Perspective
Best Served on Fire: The Twisted History of the Molotov co*cktail - Historic Mysteries
Latest Posts
streamstats - Splunk Documentation
cluster - Splunk Documentation
Article information

Author: Laurine Ryan

Last Updated:

Views: 5553

Rating: 4.7 / 5 (77 voted)

Reviews: 84% of readers found this page helpful

Author information

Name: Laurine Ryan

Birthday: 1994-12-23

Address: Suite 751 871 Lissette Throughway, West Kittie, NH 41603

Phone: +2366831109631

Job: Sales Producer

Hobby: Creative writing, Motor sports, Do it yourself, Skateboarding, Coffee roasting, Calligraphy, Stand-up comedy

Introduction: My name is Laurine Ryan, I am a adorable, fair, graceful, spotless, gorgeous, homely, cooperative person who loves writing and wants to share my knowledge and understanding with you.